Description

Buy IGF-1 LR3 1mg & 0.1mg – Receptor Grade Research Peptide

Buy IGF-1 LR3 1mg for Laboratory Research

Buy IGF-1 LR3 1mg or 0.1 mg as a research material for controlled laboratory and in-vitro studies involving insulin-like growth factor signaling. Receptor Grade IGF-1 LR3, also known as Long R3 IGF-1 or Insulin-Like Growth Factor-1 Long Arg3, is a modified 83-amino-acid analog of IGF-1 investigated in experimental research involving IGF-1 receptor signaling, cellular proliferation, differentiation, and downstream molecular pathways.

IGF-1 LR3 differs from native IGF-1 through two principal structural modifications: a 13-amino-acid extension at the N-terminus and substitution of arginine for glutamic acid at position 3. These changes distinguish the molecule from native 70-amino-acid IGF-1 and have been investigated for their effects on interactions with IGF-binding proteins and receptor-mediated signaling.

For laboratory researchers, IGF-1 LR3 provides a defined molecular tool for experimental systems investigating growth-factor biology. Research applications can include cell-culture experiments, receptor-signaling studies, comparative IGF analog research, and investigations of intracellular pathways associated with IGF-1 receptor activation.

IGF-1 LR3 Molecular Structure and Research Profile

IGF-1 LR3 is an 83-residue protein analog based on the structure of human IGF-1. Its N-terminal extension and Arg3 substitution are important distinguishing features when comparing this research molecule with native IGF-1.

One area of scientific interest is the relationship between IGF-1 LR3 and IGF-binding proteins (IGFBPs). Native IGF-1 interacts with IGFBPs, which can influence the availability of IGF molecules in experimental biological systems. Research descriptions of IGF-1 LR3 indicate substantially reduced interaction with IGFBPs compared with native IGF-1, making the analog useful for experimental investigations where IGFBP binding is an important variable.

IGF-1 LR3 is also studied in relation to IGF-1 receptor-mediated signaling. Experimental work can examine receptor activation and downstream pathways such as PI3K/Akt and MAPK/ERK, depending on the research model and assay design.

IGF-1 LR3 Chemical Specifications & CoA Summary

Specification	Research Reference
Product Name	Receptor Grade IGF-1 LR3
Alternative Names	Long R3 IGF-1; IGF-1 Long Arg3; Long R3 IGF-I
Available Quantities	1 mg and 0.1 mg
Sequence Length	83 amino acids
Amino Acid Sequence	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula	C400H625N111O115S9
Molecular Weight	Approximately 9.12 kDa; reported reference values vary by molecular form and convention
Physical Form	Lyophilized research material, where applicable to the supplied lot
Purity	Refer to the lot-specific Certificate of Analysis
Identity Testing	Refer to the lot-specific Certificate of Analysis

CoA note: Purity, identity, analytical results, and physical appearance should be confirmed against the Certificate of Analysis supplied with the specific lot. Published commercial reference records report IGF-1 LR3 molecular masses around 9.1 kDa and identify the compound as an 83-residue analog.

Key Laboratory Features & Quality Benchmarks

• Defined molecular identity: An 83-amino-acid IGF-1 analog incorporating the characteristic N-terminal extension and Arg3 modification.
• Research-focused material: Suitable for controlled laboratory investigations of IGF-related molecular biology.
• IGF signaling research: Relevant to experimental studies examining IGF-1 receptor activation and downstream signaling pathways.
• Cellular research: Applicable to appropriately designed in-vitro investigations involving proliferation, differentiation, receptor signaling, and cellular responses.
• Analytical characterization: HPLC and mass-spectrometry testing can be used to assess research-material purity and molecular identity; actual results should be taken from the applicable lot-specific CoA.
• Lyophilized format: Lyophilization is commonly used for storage of protein and peptide research materials and can facilitate controlled laboratory handling.
• Lot-specific documentation: Researchers should review the supplied CoA and product documentation before beginning experimental work.

IGF-1 LR3 Laboratory Handling, Storage & Reconstitution

Laboratory handling of IGF-1 LR3 should follow the storage and preparation instructions supplied with the specific product lot. Published research-material references commonly specify frozen storage for lyophilized IGF-1 LR3, with one current reference listing -20°C while recommending protection from light and moisture.

Because storage requirements can depend on formulation, container closure, concentration, and laboratory protocol, researchers should use the manufacturer’s lot-specific documentation as the controlling source for storage conditions and stability information.

For laboratory preparation, researchers should use an appropriate sterile laboratory diluent and follow their validated in-vitro protocol. Avoid unnecessary agitation and repeated freeze-thaw exposure where the experimental design permits. Reconstituted research material should be handled according to the researcher’s established laboratory procedures and applicable institutional requirements.

Important: This product page does not provide administration instructions or human-use preparation procedures. The material is supplied exclusively for laboratory research and scientific investigation.

IGF-1 LR3 Research Applications

IGF-1 Receptor Signaling

IGF-1 LR3 is used as an experimental analog for investigating IGF-1 receptor biology. Laboratory studies can compare receptor-mediated responses between native IGF-1 and modified IGF analogs under controlled conditions. Downstream signaling research may examine pathways including PI3K/Akt and MAPK/ERK.

Cell Proliferation and Differentiation Research

IGF signaling is an established area of research in cellular proliferation and differentiation. IGF-1 LR3 can serve as a molecular research tool in appropriately designed cell-culture experiments examining changes in receptor signaling, cellular responses, and growth-related molecular mechanisms.

IGFBP Interaction Studies

The reduced interaction of IGF-1 LR3 with IGF-binding proteins compared with native IGF-1 is an important structural characteristic investigated in research settings. This distinction allows researchers to examine how IGFBP interactions influence experimental IGF signaling systems.

Comparative IGF Analog Research

Researchers can use IGF-1 LR3 alongside native IGF-1 or other IGF-related research materials to investigate differences in molecular behavior, receptor interactions, and downstream cellular signaling. Such comparisons should be interpreted according to the specific experimental model, assay conditions, and analytical methods used.

Frequently Asked Questions About IGF-1 LR3

What is IGF-1 LR3 used for in research?

IGF-1 LR3 is used as a research molecule in laboratory and in-vitro investigations of IGF-1 receptor signaling, IGFBP interactions, cellular proliferation, differentiation, and related intracellular pathways.

What is the molecular weight of IGF-1 LR3?

IGF-1 LR3 is generally reported at approximately 9.1 kDa. Reference values around 9,117.5–9,117.6 g/mol correspond to the molecular formula supplied for the research material. Reported mass can vary according to the molecular form and calculation convention.

How should IGF-1 LR3 be stored for laboratory research?

Published research-product references commonly specify frozen storage of the lyophilized material, including -20°C, with protection from light and moisture. Researchers should follow the storage conditions provided with their specific lot and Certificate of Analysis.

How can IGF-1 LR3 purity be verified?

Purity should be verified using the lot-specific Certificate of Analysis. Analytical techniques such as reverse-phase HPLC can be used to characterize chromatographic purity, while mass spectrometry can provide molecular-identity information. The actual acceptance criteria and results should be taken from the applicable CoA rather than assumed from general reference data.

Research Use Only Disclaimer

FOR RESEARCH USE ONLY (RUO). This product is supplied strictly as a laboratory research material for in-vitro testing, scientific investigation, and analytical research. IGF-1 LR3 is NOT intended for human consumption, veterinary use, administration to humans or animals, diagnosis, treatment, prevention, mitigation, or cure of any disease or medical condition. This product is not a food, dietary supplement, cosmetic, or approved drug. It must be handled only by appropriately qualified personnel in accordance with applicable laboratory safety procedures, institutional requirements, and applicable laws and regulations. No claim is made that this product is suitable for any particular experimental application. The purchaser is responsible for determining appropriate use, handling, storage, and compliance requirements.